CAV1

CAV1
Ідентифікатори
Символи CAV1, BSCL3, CGL3, LCCNS, MSTP085, PPH3, VIP21, Caveolin 1
Зовнішні ІД OMIM: 601047 MGI: 102709 HomoloGene: 1330 GeneCards: CAV1
Пов'язані генетичні захворювання
congenital generalized lipodystrophy type 3[1]
Онтологія гена
Молекулярна функція

protein-macromolecule adaptor activity
transmembrane transporter binding
structural molecule activity
signaling receptor binding
nitric-oxide synthase binding
patched binding
enzyme binding
peptidase activator activity
GO:0001948, GO:0016582 protein binding
GO:0032947 molecular adaptor activity
protein kinase binding
ATPase binding
cholesterol binding
inward rectifier potassium channel inhibitor activity
identical protein binding
protein heterodimerization activity
GO:0032403 protein-containing complex binding

Клітинна компонента

endocytic vesicle membrane
ендосома
мембрана
focal adhesion
VCP-NPL4-UFD1 AAA ATPase complex
perinuclear region of cytoplasm
caveola
війка
apical plasma membrane
ендоплазматичний ретикулум
membrane raft
integral component of membrane
комплекс Ґольджі
early endosome membrane
клітинна мембрана
внутрішньоклітинний
cell cortex
endoplasmic reticulum membrane
Golgi membrane
integral component of plasma membrane
acrosomal membrane
basolateral plasma membrane
GO:0016023 cytoplasmic vesicle
lipid droplet
цитоплазма
GO:0009327 protein-containing complex
Сарколема

Біологічний процес

caveolin-mediated endocytosis
positive regulation of calcium ion transport into cytosol
вазоконстрикція
response to progesterone
negative regulation of protein binding
regulation of peptidase activity
protein localization to plasma membrane raft
mammary gland development
васкулогенез
negative regulation of pinocytosis
response to ischemia
Ангіогенез
apoptotic signaling pathway
positive regulation of extrinsic apoptotic signaling pathway
cholesterol homeostasis
triglyceride metabolic process
negative regulation of canonical Wnt signaling pathway
calcium ion transport
negative regulation of cell population proliferation
cellular response to transforming growth factor beta stimulus
positive regulation of toll-like receptor 3 signaling pathway
regulation of cytosolic calcium ion concentration
regulation of smooth muscle contraction
vesicle organization
negative regulation of peptidyl-tyrosine autophosphorylation
regulation of cardiac muscle cell action potential involved in regulation of contraction
negative regulation of transforming growth factor beta receptor signaling pathway
protein localization to basolateral plasma membrane
receptor internalization involved in canonical Wnt signaling pathway
regulation of membrane repolarization during action potential
positive regulation of peptidyl-serine phosphorylation
negative regulation of protein tyrosine kinase activity
regulation of entry of bacterium into host cell
negative regulation of MAP kinase activity
positive regulation of vasoconstriction
negative regulation of potassium ion transmembrane transport
лактація
receptor-mediated endocytosis of virus by host cell
regulation of blood coagulation
regulation of ventricular cardiac muscle cell action potential
protein homooligomerization
GO:0022415 viral process
positive regulation of intrinsic apoptotic signaling pathway
negative regulation of receptor signaling pathway via JAK-STAT
mammary gland involution
calcium ion homeostasis
negative regulation of necroptotic process
regulation of the force of heart contraction
lipid storage
nitric oxide homeostasis
membrane depolarization
negative regulation of cytokine-mediated signaling pathway
cellular calcium ion homeostasis
GO:1901227 negative regulation of transcription by RNA polymerase II
response to estrogen
response to calcium ion
regulation of fatty acid metabolic process
cellular response to exogenous dsRNA
negative regulation of MAPK cascade
regulation of ruffle assembly
positive regulation of protein binding
positive regulation of protein ubiquitination
negative regulation of anoikis
leukocyte migration
GO:0034613 protein localization
positive regulation of cell adhesion molecule production
response to hypoxia
negative regulation of nitric-oxide synthase activity
response to bacterium
caveola assembly
cellular response to hyperoxia
cholesterol transport
cellular response to starvation
T cell costimulation
regulation of nitric-oxide synthase activity
receptor internalization
positive regulation of peptidase activity
positive regulation of ER-associated ubiquitin-dependent protein catabolic process
negative regulation of endothelial cell proliferation
negative regulation of BMP signaling pathway
negative regulation of protein ubiquitination
cellular response to peptide hormone stimulus
GO:1901313 positive regulation of gene expression
negative regulation of nitric oxide biosynthetic process
angiotensin-activated signaling pathway involved in heart process
protein complex oligomerization
negative regulation of peptidyl-serine phosphorylation
posttranscriptional regulation of gene expression
positive regulation of gap junction assembly
maintenance of protein location in cell
negative regulation of signal transduction
regulation of the force of heart contraction by chemical signal
regulation of cell communication by electrical coupling involved in cardiac conduction
regulation of heart rate by cardiac conduction
negative regulation of epithelial cell differentiation
skeletal muscle tissue development
beta-catenin destruction complex disassembly
GO:0048554 positive regulation of catalytic activity
positive regulation of canonical Wnt signaling pathway
negative regulation of tyrosine phosphorylation of STAT protein
negative regulation of inward rectifier potassium channel activity
диференціація клітин
positive regulation of cell migration
positive regulation of cold-induced thermogenesis
positive regulation of NF-kappaB transcription factor activity

Джерела:Amigo / QuickGO
Шаблон експресії


Більше даних
Ортологи
Види Людина Миша
Entrez
857
12389
Ensembl
ENSG00000105974
ENSMUSG00000007655
UniProt
Q03135
P49817
RefSeq (мРНК)
NM_001753
NM_001172895
NM_001172896
NM_001172897
NM_001243064
NM_007616
RefSeq (білок)
NP_001166366
NP_001166367
NP_001166368
NP_001744
NP_001229993
NP_031642
Локус (UCSC) Хр. 7: 116.52 – 116.56 Mb Хр. 6: 17.31 – 17.34 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CAV1 (англ. Caveolin 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 178 амінокислот, а молекулярна маса — 20 472[5].

Послідовність амінокислот
1020304050
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEID
LVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFY
RLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSI
YVHTVCDPLFEAVGKIFSNVRINLQKEI

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як взаємодія хазяїн-вірус, ацетилювання. Локалізований у клітинній мембрані, мембрані, апараті гольджі.

Література

  • Glenney J.R. Jr. (1992). The sequence of human caveolin reveals identity with VIP21, a component of transport vesicles. FEBS Lett. 314: 45—48. PMID 1360410 DOI:10.1016/0014-5793(92)81458-X
  • Engelman J.A., Zhang X.L., Lisanti M.P. (1999). Sequence and detailed organization of the human caveolin-1 and -2 genes located near the D7S522 locus (7q31.1). Methylation of a CpG island in the 5' promoter region of the caveolin-1 gene in human breast cancer cell lines. FEBS Lett. 448: 221—230. PMID 10218480 DOI:10.1016/S0014-5793(99)00365-8
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Vainonen J.P., Aboulaich N., Turkina M.V., Stralfors P., Vener A.V. (2004). N-terminal processing and modifications of caveolin-1 in caveolae from human adipocytes. Biochem. Biophys. Res. Commun. 320: 480—486. PMID 15219854 DOI:10.1016/j.bbrc.2004.05.196
  • Aboulaich N., Vainonen J.P., Stralfors P., Vener A.V. (2004). Vectorial proteomics reveal targeting, phosphorylation and specific fragmentation of polymerase I and transcript release factor (PTRF) at the surface of caveolae in human adipocytes. Biochem. J. 383: 237—248. PMID 15242332 DOI:10.1042/BJ20040647
  • Li S., Seitz R., Lisanti M.P. (1996). Phosphorylation of caveolin by src tyrosine kinases. The alpha-isoform of caveolin is selectively phosphorylated by v-Src in vivo. J. Biol. Chem. 271: 3863—3868. PMID 8632005 DOI:10.1074/jbc.271.7.3863

Примітки

  1. Захворювання, генетично пов'язані з CAV1 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:1527 (англ.) . Архів оригіналу за 26 жовтня 2017. Процитовано 7 вересня 2017.
  5. UniProt, Q03135 (англ.) . Архів оригіналу за 2 вересня 2017. Процитовано 7 вересня 2017.

Див. також

  • Хромосома 7
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»